PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_5869.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YA
Protein Properties Length: 231aa    MW: 24482.5 Da    PI: 8.741
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_5869.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA51.63e-16179213136
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36 
                  +ep+YVNaKQy++Il+RRq+Rak+e e+k  +k+rk
  MLOC_5869.2 179 EEPVYVNAKQYHGILRRRQSRAKAELERKA-IKARK 213
                  69***************************6.66655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.0E-6177227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115220.592178231IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.2E-12180231IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860183203IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSGMGSRPGE SNLVEPRGLP SGGMAMQPWW TGSGFGAVSP AVVAPGSAAG ISLSSNPLGG  60
GAAKGAAQGK KKKKKTVDDD DDARGESSDD DSPRSGEPKD GSFDEEKQHA ASRMPALASD  120
YLPPYSQLEL SQPMASAPYP YPDAYYAGMV GPYGAQAVAH FQLPGLTHSR MPLPLEVSEE  180
PVYVNAKQYH GILRRRQSRA KAELERKAIK ARKFGSSISS CVRCCAQPYL H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3541160.0AK354116.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1005C04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752976.11e-111PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_010231280.11e-111PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752975.11e-111PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_003560983.11e-111PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLM0XBV41e-169M0XBV4_HORVD; Uncharacterized protein
STRINGMLOC_5869.11e-168(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-20nuclear factor Y, subunit A9